Protein Info for BBR_RS10800 in Bifidobacterium breve UCC2003

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02826: 2-Hacid_dh_C
  • amino acids 6 to 87 (82 residues), 29.8 bits, E=9.5e-11
• TIGR00465: ketol-acid reductoisomerase
  • amino acids 16 to 327 (312 residues), 399.2 bits, E=5.4e-124
• PF07991: IlvN
  • amino acids 16 to 179 (164 residues), 253.2 bits, E=2.2e-79
• PF03446: NAD_binding_2
  • amino acids 20 to 105 (86 residues), 30.1 bits, E=1.2e-10
• PF03807: F420_oxidored
  • amino acids 20 to 96 (77 residues), 33.8 bits, E=1.1e-11
• PF01450: IlvC
  • amino acids 185 to 326 (142 residues), 176.7 bits, E=8.3e-56

Best Hits

Swiss-Prot: 98% identical to ILVC2_BIFLO: Ketol-acid reductoisomerase (NADP(+)) 2 (ilvC2) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 99% identity to bll:BLJ_0103)

MetaCyc: 57% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• phosphopantothenate biosynthesis I (2/4 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• phosphopantothenate biosynthesis III (archaea) (1/4 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (4/9 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (2/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.86

Use Curated BLAST to search for 1.1.1.86

Protein Sequence (350 amino acids)

>BBR_RS10800 ketol-acid reductoisomerase (Bifidobacterium breve UCC2003)
MAATIWYEKDADLSVFDGKKVAILGYGSQGHAHALNLRDSGVDVVVGLRPSSKSVEFAKE
QGLEVKPVGEAVAEADVVMILLPDQYQAKVYEEEVEPNLKPGAALAFAHGFNIHYGYIKP
SEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAVEQDPDGKTWPLCLAYAKALGALRAGA
IKTTFTEETETDLFGEQDVLMGGINHLCDLGFDVLTEAGYQPEIAYFEVFHELKMLVDLA
NEGGLNKARWSCSDTAQYGDYTSTVITDETKKRMQYQLKRIQDGSFAKEFMDDQAAGAPK
FKKLQEEFSHPHLETVGPKLRAMFSWNNAEAKDKDEAESFNGKIARTQVQ