Protein Info for BBR_RS10795 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 359 to 383 (25 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 29 to 239 (211 residues), 98.8 bits, see alignment E=3.4e-32 amino acids 291 to 454 (164 residues), 46.7 bits, see alignment E=2.3e-16 PF07690: MFS_1" amino acids 36 to 399 (364 residues), 97.6 bits, see alignment E=7.6e-32 amino acids 291 to 444 (154 residues), 40.7 bits, see alignment E=1.5e-14

Best Hits

Swiss-Prot: 50% identical to YHJE_ECOLI: Inner membrane metabolite transport protein YhjE (yhjE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to blf:BLIF_0099)

Predicted SEED Role

"transmembrane transport protein possibly for shikimate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>BBR_RS10795 MFS transporter (Bifidobacterium breve UCC2003)
MTAAVEETGLGQAASKATAMVRDSVKTVIAASMVGTAIEFYDFYAYGTAAANYFPHIFFS
DKANPTVALLMSLLTFAIAFIARPLGSLVFGHFGDRMGRKTTLVVSLMTMGVGTFLIGCL
PTYDQVGVAAVAILCLLRFIQGIGLGGEWSGAALVATENAPEDKRALYGSFPELGAPIGF
FLSNGTYFVLESFNDQSAMLAWGWRVPFLLSAILVIVGLVVRVHMEETPIFRMAQEQKKV
VKSPLTEVFRKSWRQVLQATFLVAVTYTLFYTLATWSLAWGTKDTANGGGNLGFNNQEYL
LMLMISICVFALFIVLSCLYADKLGRRRVLTFSSCALVVFAVLFPFLLDGQVVGQRNFFA
NMVFLCVGFALMGIAFGPIGAFLPELFDANVRYSGSGIGYNLAAIVGAAFVPTIATWLAH
NWGVHSVGLYLAVMAVCCLVSVLTCKETKDVDFTK