Protein Info for BBR_RS10785 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 103 to 125 (23 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 417 to 440 (24 residues), see Phobius details amino acids 453 to 476 (24 residues), see Phobius details amino acids 491 to 514 (24 residues), see Phobius details amino acids 520 to 539 (20 residues), see Phobius details PF07690: MFS_1" amino acids 164 to 499 (336 residues), 66.8 bits, see alignment E=1.7e-22 PF13347: MFS_2" amino acids 166 to 514 (349 residues), 46.5 bits, see alignment E=2.1e-16

Best Hits

KEGG orthology group: None (inferred from 97% identity to bln:Blon_0129)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>BBR_RS10785 MFS transporter (Bifidobacterium breve UCC2003)
MLEPYVRPGIDDRPDLDKALSPEDKDAVARLAIKDRRRPPEASADQPEAQAVRLAAAGSS
AAAAAAASVDAPAPDLSSAYLDMRDPMVAANGQRPTAVQISRLNWGFFVASILVGAPWAA
LNTIAMPNAVARLFDYDTASAISVTINPSTGRPLPVATDLVVPLAVLVVVGVVASMFAMP
LVSALSDRTRIPLGRRTPWMVAGGVLCALITLVLGQNTGLVVLCFFWALMQFAYAMISVP
LASAISERVPDKFRPRIERWHGIGVMLGQALGVCMGALGVMFDSFTPFAYTAVLFAVSGI
LTVIVLPKEPSSQEQPHQRFESSQVFDQLRPPAHAPAFARVFAARVCMMTGVGLTGVFLW
YLVRFWVYGKAVVFTSAPLTIPAGLLIAGMAAATLIGAALASWAAGPISEKIEERNIATT
AVVAASCLLYAIGVAVAWGLGVWSTGTARENGMLLFALISGFAFGVYDALGLELVMNALP
DPRNAGHDLGIYALANSVGLALAAIIGAVLVSAFASSFGYYLLFPSAIVMVFLAGIITLS
SKAE