Protein Info for BBR_RS10760 in Bifidobacterium breve UCC2003

Annotation: ClC family H(+)/Cl(-) exchange transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 367 to 392 (26 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 78 to 418 (341 residues), 313.1 bits, see alignment E=2.5e-97 PF02080: TrkA_C" amino acids 451 to 516 (66 residues), 52.9 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: None (inferred from 99% identity to blf:BLIF_0082)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>BBR_RS10760 ClC family H(+)/Cl(-) exchange transporter (Bifidobacterium breve UCC2003)
MTGNDAAHDIRRLIPRFDHLKWKMAAAGIVIGLVSGLLVVVYRLGIEYGTDASRWIYARI
RETPWLIAPWAVAAVAAALAIAWMVGKEPMAGGSGIPQTNGVVICGLKMRWQTILPVRFV
GGLLGALFGLSLGREGPSIQIGASGAQCVSHRLRGRRREDMQEHYLVTAGAAAGLSAAFS
APLSGMMFALEGVHRSFSPAILMGATAASLTADFVSKYCFGLRPVLDFGDIGQLSLEEYV
WLIPLGLVAGLVGSLMNRSLLGFQTLYGKLPAWSRPMIAIAIALPVGIWLPDVLGGGSNL
IDTAEHARVGLGMLCLLFVAKMLFTSTSFGSGAPGGIFMPILAVGSLAGGICGEVLHRFG
NLPSDAVAVFAVCVMTGTLAASVKTPITSILLAVEMSGTLTHMLPVAAVAFIALLVSDLL
RTKPIYGELLERYVRAQGMQMAIASHVGSGIMELPLEMGAIADGKRVRDVRWPSGCLIIG
LRRGESEIVPRGDTRLRAGDYLVVLFSGEEEREVRPAMRRLCDARLD