Protein Info for BBR_RS10745 in Bifidobacterium breve UCC2003

Annotation: DUF6 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 278 to 309 (32 residues), see Phobius details PF00892: EamA" amino acids 27 to 165 (139 residues), 66.7 bits, see alignment E=1.2e-22 amino acids 178 to 310 (133 residues), 61.8 bits, see alignment E=4e-21

Best Hits

KEGG orthology group: None (inferred from 70% identity to bbi:BBIF_0146)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>BBR_RS10745 DUF6 domain-containing protein (Bifidobacterium breve UCC2003)
MCEPKTAATNGQPTPTLERTPHDIFVGAGLALAGGVFWGVNATVSKLLMNDYHADPLWIA
CVRELLAGVIFLVCAGIFTPDKFINSLKDYRSYPRLLLCAFFCVLMVQVSYLKAIDWTNS
GMATVLQTLNLLVVLVFVCIMGKRLPGKRESIGVVLAFVGTVLIATGGDLSQLSLPLPGL
LWGLTDAVCTSLLAILPIALMAKWGNFMANGVMFIVSGLMLLPLVHPWTTAPALDWFGIG
LMVFTVVFGTFGAYWLFLGGTQRCGAMRATMLGTSEPVTATITGVLFAGAVFTPTDLVGF
AMIIIMVFLVR