Protein Info for BBR_RS10735 in Bifidobacterium breve UCC2003

Annotation: zinc metalloprotease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details PF01435: Peptidase_M48" amino acids 75 to 293 (219 residues), 115.9 bits, see alignment E=1e-37

Best Hits

Swiss-Prot: 92% identical to HTPX_BIFLO: Protease HtpX homolog (htpX) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 97% identity to bll:BLJ_0084)

Predicted SEED Role

"Peptidase M48, Ste24p precursor"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>BBR_RS10735 zinc metalloprotease HtpX (Bifidobacterium breve UCC2003)
MDAKVRVHGHFNGLKTTLLFALMWAIIMLIWWATGGRQQTLGIYVIIGLATTFGSYWFSD
KLAIASMGAREVSEQEAPEIYQIVRELSAKAGKPMPRIYIAPTMSPNAFATGRNERHAAV
CCTQGILQILNARELRGVLGHELMHVYNRDILTSAIASAMATVITYLGYSLMYFGGGNSR
DDRDNSGGLGLIGVLLSVILAPIAASLIQMAISRTREYDADEDGSLLTGDPEALASALNK
ISYGAQTTPMRKTAGTQSVSAMMIANPFSAVGFSKLFSTHPPTDQRIARLMQMANEMNGT
PVAASTYSTRAIH