Protein Info for BBR_RS10720 in Bifidobacterium breve UCC2003

Annotation: PDZ domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 transmembrane" amino acids 227 to 250 (24 residues), see Phobius details PF00089: Trypsin" amino acids 301 to 463 (163 residues), 64.3 bits, see alignment E=3.6e-21 PF13365: Trypsin_2" amino acids 311 to 452 (142 residues), 119.7 bits, see alignment E=4.4e-38 PF13180: PDZ_2" amino acids 507 to 590 (84 residues), 49 bits, see alignment E=1.6e-16 PF17820: PDZ_6" amino acids 528 to 579 (52 residues), 34.2 bits, see alignment 4.4e-12

Best Hits

KEGG orthology group: K08372, putative serine protease PepD [EC: 3.4.21.-] (inferred from 80% identity to blj:BLD_1353)

Predicted SEED Role

"FIG00672241: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (651 amino acids)

>BBR_RS10720 PDZ domain-containing protein (Bifidobacterium breve UCC2003)
MADEFNPQGVDQTPQNNENPAPNGNETEPQTSAQNAAEGDVATNPSHEDGSPTQQMLSTQ
NDAPTATTEPIPDYAAAKGESTVVSSAPASTPAADTQSATPLYRPAPEFGAYGPTPTQPE
QSASNTAQQGAQPTQQFPYGQAFSQQPQGQRNPYFTNNQQQGNSNPFNPQPQQPQNNGNP
FATPNGQRQGGLFGFGSGAGTPNGQNPQGPQGPAQPNRPGLSKTANAIVVAVVAALVAAA
LCLGLGYAAITNGWVTVPTSSSLSSVTSNKSGSGSATAKTGEAPDWQTVASGVSGSVVSI
QTAMANGTAKGSGAIIDAEGHIITNNHVISGAQQIQVTLANGNIYSAQLVGTDTTTDLAV
IKLDNPPSGLKAVEFADSDKLAVGENVMAIGNPLGYDDTATTGIVSALNRPVTVTDDNNN
EIVTNAVQIDAAINPGNSGGPTFNAAGQVIGINSSIASTATSSDSAGSIGIGFAIPSNLV
KRVADEIIKDGSVKHVALGVVIKSDTVEADGVTRGGATITKSSATGSAVVSGGPADKAGL
KEGDTIVAFNGNAVNNNYSLLGFVRAAALGDKATLTIVRDGKTMDVDVTLDQEESSVNGS
SSSNSNGNNQNNQNNQNNQNGNGRNGYGNGNGNNDGGTGDGGGFSDPFGLW