Protein Info for BBR_RS10705 in Bifidobacterium breve UCC2003

Annotation: hemolysin-III-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 82 to 105 (24 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details PF03006: HlyIII" amino acids 72 to 275 (204 residues), 171.9 bits, see alignment E=8.5e-55

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 94% identity to bll:BLJ_0076)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>BBR_RS10705 hemolysin-III-like protein (Bifidobacterium breve UCC2003)
MSVSISTPSGRKMASASTVTPSVTASQKSGASTGPAALDRASARYKAAQSRYRQAKAALK
AVKRQIVPVDAFGIRKPRLRGWLHLATLPLCIAASIVLICIAPAGPVKAACAVYGASAML
LFGNSALLHVVPWRSAKVTRVLCGIDYSNIFLIIAGTNTPVLFALSPAIRRPYLTVIWVT
AAIGTILHIVWLRTPNWVFTTVYVVLGLAPVTLIPQLWTAPAVGPAATILIACGGAAYIA
GAVCFALRKPNPVPGWFEFHEVFHLGTVIGYACHVVAIYLIVCAL