Protein Info for BBR_RS10695 in Bifidobacterium breve UCC2003

Annotation: (deoxy)nucleoside triphosphate pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 11 to 125 (115 residues), 59.9 bits, E=2.7e-20
• PF14815: NUDIX_4
  • amino acids 14 to 125 (112 residues), 59.3 bits, E=3.1e-20

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to bll:BLJ_0074)

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (137 amino acids)

>BBR_RS10695 (deoxy)nucleoside triphosphate pyrophosphohydrolase (Bifidobacterium breve UCC2003)
MERERKIINVVGAAIVTNGTVLCAQRGPGKSLAGYWEFPGGKIEPHETARQALHREIEEE
LLCEVEVAEEVCTSEYAYDFGTVRLTTFICHLIAGTPHLTEHTDIRWLNPADMPTLNWAP
VDREAVAIIANKQLTLR