Protein Info for BBR_RS10665 in Bifidobacterium breve UCC2003

Annotation: DUF2156 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 874 transmembrane" amino acids 49 to 76 (28 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 191 to 208 (18 residues), see Phobius details amino acids 212 to 229 (18 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 484 to 507 (24 residues), see Phobius details PF09924: LPG_synthase_C" amino acids 525 to 839 (315 residues), 271.6 bits, see alignment E=3.6e-85

Best Hits

KEGG orthology group: None (inferred from 91% identity to blj:BLD_1364)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (874 amino acids)

>BBR_RS10665 DUF2156 domain-containing protein (Bifidobacterium breve UCC2003)
MSDEQQHEGGRKPQTSHASKSHAPKSGHVADSWRELAEDARQWADGHRLAVVATTVLVVL
NLVVWLVAAMAGFAFPLRLDTSMAEFDLGKLVCSLFLARGVIQLIIDAVLWLVMFSIAEP
WLGRTRTVAAALACAAAGALIGLGLCAAAGWLFQDSQFVSRMRFALSPLVLPVGALMAAS
AFCGHLWRRRIRLIGYVAILVALLYSGNPGDYCILAAALLGHIAGRVMAGPPAHAETGWH
WLRSTSFEARRMFAAIAVVLALGPVISITSHNHAGPLSTVGLLMSPASVDNGTLAKCLAG
ATHSGCFLQFDLLRASMPGAVLRSLLPTAVTLVLAWGLYRGRRFAAICAVAINLFTAGVA
IAYYLVVPLSFAPNGMTSLLQHGAITACVANALPPLIFAVALAAMLKHFPIRVGWRRLIG
GVGVIVLVLLACAAVYLMYGIAQPDAFAPRATASSLLAELPGRFLPIGFLSHMKLSFVPR
TPLASVVYQGVGLVFWIVVLAVVMRWMSDVSESNERAQARAERLVETGGESMSFMTTWEG
NDYWLSPTGKSAVAYRVLNGIALTCTGPFGDPAEWMDDLTGFTQYCVERSWSPVFYSVHR
EQRDALLAEGWNSIEVGSEMVVDPRVWKTTGKKWQDVRTAINKAKRDGITDVQSTFLESP
LEVREQIEDISEEWAQLKALPEMKFTLGGVEELRDPRVRLLYAVDADGRVLGVTSWLPTW
RDGRVIGWTLDFMRHRTDSPNGIMEFLIARMAERLRDEGAADPERAAEFMSLSAAPLAGM
NPERDNAGEGGAPAGEGTQVLQHALQIVADWMEPAYGFHSLFNFKRKFQPTEAPVYVCYP
DPAALPQIGLAVVRAYVPSVTPAEVAGMLSTLRS