Protein Info for BBR_RS10650 in Bifidobacterium breve UCC2003

Annotation: drug/metabolite DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details PF00892: EamA" amino acids 185 to 315 (131 residues), 37.9 bits, see alignment E=9.8e-14

Best Hits

KEGG orthology group: None (inferred from 89% identity to blj:BLD_1367)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>BBR_RS10650 drug/metabolite DMT transporter permease (Bifidobacterium breve UCC2003)
MADDARNASGTPAPTASHAGHSGGHVVSSRATAVGLMAIVLWSFMTGTVRIVAESFGATL
GSALIYTVGGVLLLVFRRPAPIREFPKKYLIIGGLLFVFYESSISLSLGLASTAASSVEV
SLVNYLWPTMMVLLAAGVSRRRHAVWKVLPGAIVATVGVALAVGGNSGLDWQAAAGHIAD
NPLPYVLAFAGALAWSVYAVFTPAWSHGVDGTSVFFPCVAVALWIIHFASGQGWPAEPPS
LVAWLFVFIAAAAIGGGYACWGYGILHGSMERLAIASYATPVLSTGASAVLLGLALSLPF
WCGALLVAAGSVLNYLVSARRSDPTT