Protein Info for BBR_RS10615 in Bifidobacterium breve UCC2003

Annotation: FtsW/RodA/SpoVE family cell cycle protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 535 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 372 to 396 (25 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details PF01098: FTSW_RODA_SPOVE" amino acids 67 to 429 (363 residues), 235.6 bits, see alignment E=4.3e-74

Best Hits

KEGG orthology group: None (inferred from 82% identity to blo:BL0586)

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (535 amino acids)

>BBR_RS10615 FtsW/RodA/SpoVE family cell cycle protein (Bifidobacterium breve UCC2003)
MIATRFRQIALLLLAVAISALAFIQMFQRTTGAFPVQYAIMLCAAAALFLVFCGLTARFQ
PYASQSIMPCVLLLTATGITMIARIDQSEGWDIAKRQIIWLYVALVLSTLIIVFLRDYRV
LRRFSYVSMVVGLILLLSPMLPVIGTEINGARIWVRIPGLGSFQPGEFAKLFLAFFFAAY
LFDHRDQLAVGGKKVLGLQLPRIKDLGPIIVVWIASMGVLVVQHDLGTSLMFFAMFVAML
YTSTGRKSWIVIGLITFAAGAMLAASMFSHVGSRVDAWLHPFSNEQYTKSPGGSWQLVTG
IFGLASGGMIGTGLGQGHPSLVTFANSDFIYASLGEELGLVGVMAILMLYLIIIASGFIV
AMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTGLTLPYMAAGGSSLIANYILAA
LLIVISNSANQPEPELTSDTFQHEALAALRNKELKARARATEPIVRPRVASATPHDVSEE
ANDPQIPNTAEEPEYTVRTGVLPSVPQVPSMPPAPPVPQIQTNFPIDTSNGGERA