Protein Info for BBR_RS10590 in Bifidobacterium breve UCC2003

Annotation: class E sortase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 49 to 74 (26 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details PF04203: Sortase" amino acids 133 to 264 (132 residues), 104.4 bits, see alignment E=1.9e-34

Best Hits

KEGG orthology group: None (inferred from 85% identity to bll:BLJ_0049)

Predicted SEED Role

"Sortase (surface protein transpeptidase)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>BBR_RS10590 class E sortase (Bifidobacterium breve UCC2003)
MRHGNHSSDASIAMDNVPAYAAGAGSAASVQPSRGGDSRRRPSAPRRGALWQVLGIIAEL
LLTAAAICALYIVWQMWWTGVEAEQAQNETTQSVNWSDPSNNGGDVKVAEAQEGDPPVQP
EKPAYGDLIAQVYIPRFGSQWHRNLVEGTTLEQLNRHGLGHYQDTQMPGQVGNFAVAGHR
NGYGQPLGDVDKLQEGDPIIIRTKDYWYVYHYTRYEIVLPTDIYVIAPNPENSGVEPTKR
MITLTTCEPKYSTPTRRWISYGELAYWAKVSDGVPKELTTTDSSGEVRFATKETPSLVSK
IGSLDEVVYGALGAWLILFIAAAVAWRWPVLKAIRLGERRRPDASIYGTLLRLQPGVAPI
RWLLLAVLLFAGAAALFQWVFPWAAANIPFLQQMSNFVVSN