Protein Info for BBR_RS10575 in Bifidobacterium breve UCC2003

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details PF01694: Rhomboid" amino acids 62 to 203 (142 residues), 94.4 bits, see alignment E=3.5e-31

Best Hits

KEGG orthology group: None (inferred from 82% identity to blo:BL0594)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>BBR_RS10575 rhomboid family intramembrane serine protease (Bifidobacterium breve UCC2003)
MHMPTKQEIRYQWEHGGPVMTWALIAACTAVWLVEVLLGFLSPTLQNWLIYRGMLAPATM
LAEPWAIVTSMFLHSPNSILHILFNMIALYSVGPVLERLIGHWRFLGLYMISGLGGALGM
MVWAVVAPGGQGWQTAAYGASGALFGLFAALLVVYRRIGADIRSMLIWMAVNFALPFVVG
GVAWQAHVGGFVVGGLLTWLLIGGIRPWRGKSLAWRMQVYGWSVTVLVIALIVACNFANP
YGWMWR