Protein Info for BBR_RS10530 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 transmembrane" amino acids 357 to 376 (20 residues), see Phobius details amino acids 379 to 394 (16 residues), see Phobius details amino acids 407 to 429 (23 residues), see Phobius details amino acids 441 to 462 (22 residues), see Phobius details amino acids 474 to 497 (24 residues), see Phobius details amino acids 510 to 531 (22 residues), see Phobius details amino acids 537 to 554 (18 residues), see Phobius details amino acids 561 to 581 (21 residues), see Phobius details amino acids 595 to 615 (21 residues), see Phobius details amino acids 632 to 653 (22 residues), see Phobius details PF06738: ThrE" amino acids 55 to 132 (78 residues), 37.2 bits, see alignment E=2.3e-13 amino acids 332 to 495 (164 residues), 129.8 bits, see alignment E=1.2e-41 amino acids 513 to 650 (138 residues), 38.8 bits, see alignment E=7.3e-14 PF12821: ThrE_2" amino acids 517 to 651 (135 residues), 68.3 bits, see alignment E=7.4e-23

Best Hits

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (662 amino acids)

>BBR_RS10530 hypothetical protein (Bifidobacterium breve UCC2003)
MDNVSEQKKNNAPEAKGASAVRKFHTHSIPLDMEDIARDWDKPVVDAGIAAKASVIVRVG
MLDLGAGTGSFRVREMMHRIAYPLGVHVRADVNLTDIEATCTDGRNRITEIVDLPTTGVN
TERIWLLEHFADWFSVNLGKGSMYHVDSQLSDGVVKHLDERDASQYSADLSKRLRERAKA
RAAAADGSVDDALDVALRAKVTVTSVARSLDDDNEEAHRLLADSEKVTPIEDKAAEEKAY
DDAEVFAGDSNEAVEAASSAGAESLMRHEAGNAPDNDENAAGEPARSDGSGVRASEGDAA
DAATEPSSAKRKSRVPKEYAEHFNERSDEEKAKGGITVRQAHERLDLIERRKPLYKPWFS
GLASALACAAFVFLLGGGPYDMIGAFVGAGLGQWMRRRLFAHHLNQFFVTFVCVAAAALA
CTGTLRLIGIFDPVALSHDTAYIGAMLFVIPGFPLITGGLDMAKIDFPSGIQRVAYVLCI
ILMATLAGWAVAVMVHLHPEGFEPLGLNPWVNGLLRFVAAFVGVWGFSVLFNSPQRMCLT
AALIGAITDTLRLELQDFSVAPEMATFIGAFLAGVLASAWRSSVRRGWLPPHLGYPRICL
TVPSIVIMVPGLYMYRAMWYLGSFDTVNALDWAFRAFMVIVCLPIGLAMARVATDKSWRY
DI