Protein Info for BBR_RS10505 in Bifidobacterium breve UCC2003

Annotation: DUF4956 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 84 (32 residues), see Phobius details amino acids 104 to 136 (33 residues), see Phobius details PF16316: DUF4956" amino acids 35 to 136 (102 residues), 40 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 97% identity to bll:BLJ_1526)

Predicted SEED Role

"FIG01032341: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>BBR_RS10505 DUF4956 domain-containing protein (Bifidobacterium breve UCC2003)
MSVNDMIKKSVLKSFSQYNVPKMALALLVALIVGIVIYYVYRRFYTGVVYSRSFAVTLVG
MSVLTCMVTLSISTNIVISLGMVGALSIVRYRTAVKDPMDLLYLFWSITSGIAAGAGMYV
LVIVAGLVMIGMLALFYSHQDKGRVYIAVIHYMGDMVGDEITRAFGRTKFFVKSKTMRGE
RTEMAVEVFCDDKDMAFAERIRAIDGVEDVTLIQYNGEYHG