Protein Info for BBR_RS10490 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 23 to 49 (27 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 273 to 297 (25 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 367 to 392 (26 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 424 to 444 (21 residues), see Phobius details PF16933: PelG" amino acids 1 to 454 (454 residues), 449.6 bits, see alignment E=6.7e-139

Best Hits

KEGG orthology group: None (inferred from 98% identity to bll:BLJ_1529)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>BBR_RS10490 hypothetical protein (Bifidobacterium breve UCC2003)
MAGIGFELKKLFHRRGLMAMLRAYGYAGVICAGPMLLGVLLQFGVLIVSSWWQVGRPDRD
LLVCMITYTLLASLVLTSFLSMPVTRFLADMLFDHDEKMILPSFWGSTGIMLVVGAVLYT
VFLLFSGATLMQGVLCLWLFLEMVVNWNAMSYLTAIKDYKSILYSFAAAVLVAFITSCVL
LALALPPVESLLFAVVLGYGVMLVWDVLLLHRYFPQSRENPWLFLQWVDQFLPLALTGLF
TTIGLFVHLVITWCGPLGIKVKGLFYGAPYYDVPAMLAFLTILITTVNFVVSVEVNFYPT
YRSYYSLLNDGGTVKDITVAENEMLAVLNRELHYTALKQLLVTAAVISLEKTALNALPLG
FNDVMHGYFRVLCVGYALYAVGNTVMLILLYFTDYSGALTASALFAGSTVIFTVIGQFFT
TTLFGFGFLMGASLFAIHATFRLASYTDNLPYRVLGQQPIVAQTKRGRFTELGILLEHGE
QRIDQSLHRTEYKGHVRRECGTNITEANNTIGEES