Protein Info for BBR_RS10455 in Bifidobacterium breve UCC2003

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 53 to 222 (170 residues), 131.7 bits, E=1.5e-42

Best Hits

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 94% identity to blo:BL0616)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• cyanate degradation (2/3 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (6/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (2/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (6/14 steps found)
• 3-hydroxypropanoate cycle (4/13 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (7/18 steps found)
• glyoxylate assimilation (3/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (4/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (4/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (16/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.1

Protein Sequence (227 amino acids)

>BBR_RS10455 carbonic anhydrase (Bifidobacterium breve UCC2003)
MAQADVEQESTANATWSRMLQGNRRFAEGKPDHPWQDKETRQTLLDGQNPDAAVLACSDS
RVPPEIIFDEGLGDLFTVRTAGQLIDSAVIASLEYAVKKLHVSLICVLGHEHCGAIEAAT
QELDDLMRTITSEADGSLEAADAMDDLDEHIATAESIILRQAGMSVWQAREAELEEHEDI
ERVHVAHTIETLAEQSPVIQQALADDKLMIVGARYQLDSGKVEVLSF