Protein Info for BBR_RS10445 in Bifidobacterium breve UCC2003

Annotation: HlyC/CorC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 60 to 86 (27 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details PF01595: CNNM" amino acids 9 to 190 (182 residues), 137 bits, see alignment E=8.3e-44 PF00571: CBS" amino acids 212 to 268 (57 residues), 34.5 bits, see alignment 3.1e-12 amino acids 276 to 330 (55 residues), 21.5 bits, see alignment 3.7e-08 PF03471: CorC_HlyC" amino acids 358 to 428 (71 residues), 57.8 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: K03699, putative hemolysin (inferred from 100% identity to bln:Blon_0030)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>BBR_RS10445 HlyC/CorC family transporter (Bifidobacterium breve UCC2003)
MSLGLNILLIFVFLVIGSVFSGTELALVSLRGSQIEQMEQEDARGAKVAKIARDPNTFLS
TVQIGVTLSGFLSASFGASSIAPYLIPVVESWGVHPGIAGGLVNIILTLIISYCSIVISE
MVPKRIAMQRTEQIARAVVPAIDAFAAVCRPIIWLIGKNTNGIVRLLGFDPQQTESEVSD
DELRVLVSSNTNLSKDERTILDDVFDASETIVAEVMRPRADVVFIEGDQPLAEAAAFVRD
QPYSRYPVTGKDFDDVIGFVHVRDLLDVRDPNAKIVRDVVREGISLPGTSKLLPSLELLR
KRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLPSEKGGERTTRTAFVNGVATI
EASMTIEDFADLTGIELEDGPYETVAGYFLSKTGKMGAMGDVLHSDDGYNMVITKVDGRR
IETIEVRKAGAPDHAPLPEEPQTDDAN