Protein Info for BBR_RS10315 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details PF18948: DUF5692" amino acids 8 to 322 (315 residues), 465.9 bits, see alignment E=2.8e-144

Best Hits

KEGG orthology group: None (inferred from 96% identity to blj:BLD_1424)

Predicted SEED Role

"FIG00426934: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>BBR_RS10315 hypothetical protein (Bifidobacterium breve UCC2003)
MLFQVYGDNAIYQWIGWILVFCCLIGANELARRTKTGGIVAFLVVPAVLTVYFITIYTAA
AMGADWALNNPTYVHMTSWFHYAKLYAATIGCIGFMALKYKWGSIGKSHWFKCFPFVIVA
INILIAVVSDFESAIRGWDTTWISTEGVTLYGGWHNVFNGLAGILNIFCMTGWFGIYASK
KKDDMLWPDMTWVFIVAYDLWNFCYTYNCLPTHSWYCGLALLLAPTVANFFWNKGGWIQN
RANTLAIWCMFAQVFPMFQDYSVFSTQSVNNPNVNLAVSLIALVANVLALGYILLRAKKQ
GINPWTKEVFKGTKDYEQAIARADASELVA