Protein Info for Ac3H11_905 in Acidovorax sp. GW101-3H11

Annotation: Rhodanese domain protein UPF0176, cyanobacterial/alphaproteobacterial subgroup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF17773: UPF0176_N" amino acids 10 to 99 (90 residues), 93.5 bits, see alignment E=8.5e-31 PF00581: Rhodanese" amino acids 120 to 217 (98 residues), 34 bits, see alignment E=3.4e-12

Best Hits

Swiss-Prot: 62% identical to Y1961_RHOFT: UPF0176 protein Rfer_1961 (Rfer_1961) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K07146, UPF0176 protein (inferred from 68% identity to pol:Bpro_2937)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JRW8 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Ac3H11_905 Rhodanese domain protein UPF0176, cyanobacterial/alphaproteobacterial subgroup (Acidovorax sp. GW101-3H11)
VDSVTPRFLTAALYQFVDLPDFAALREPLQSLCDTHGVRGMLLLAPEGINGTIAGEPQGV
HAVLAGLRSDARFAALQHKEARAERMPFYRMRVRLKREIVTLGVPGLNPARNAGTYVKPE
DWNALIDDPGVVVVDTRNDYEVGIGTFERAVNPHTKTFAEFPAWVEREEQPGGVLAGKPR
VAMFCTGGIRCEKSTAFLKSQGFDEVYHLEGGILKYLETVPEEASRWHGDCFVFDERVSV
GHGLVPGHYQLCRSCRMPLGEAELHSSHYVPGVSCPYCHGTRTPEQERALAERERQMQLA
RQRGQEHIGAQQPGRPARTAARDAADDGMDGPT