Protein Info for Ac3H11_858 in Acidovorax sp. GW101-3H11

Annotation: oxidoreductase, FAD-binding, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF01565: FAD_binding_4" amino acids 51 to 182 (132 residues), 85 bits, see alignment E=2e-28

Best Hits

KEGG orthology group: None (inferred from 55% identity to pba:PSEBR_a2576)

Predicted SEED Role

"oxidoreductase, FAD-binding, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JF77 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Ac3H11_858 oxidoreductase, FAD-binding, putative (Acidovorax sp. GW101-3H11)
VVGTAPHGLRRRELLGALAAAGLLGAVPRPAHSAPGTLIENVTRLYPVRVARVVVPTRVQ
DVVHAVQHWPGAVAVGGGRYSMGGQVGVEGGLHIDMRRMNALVWLDAPARTVRVQAGMRW
RDLQDHLDPHDLAVRTMQSYSNFTVGGSVSVNVHGRYVGHGPIGASVRALQIVLASGEVR
EASRQQHPDLFRAALGGYGGLGVITEVELDLDPNTAIERSVAQVALDDYPGFFAAKVHAN
ARAVMHNADLLPPHFDRATAVTWATTDRPVTVPERLVPRGQRYDLDKTVIWALTELPGGH
QLQHKVVRPALLRGQPVVWRNREASLDAASLEPASRAQSTYVLQEYFVPVARFAAFTRGL
ARILQQHGAQVLNISVRHAPPDPDAVMAWAREEVFSWVLYFKQGTSAEAQEGVGLWTRAL
IDLALQHGGTYYLPYQRHATQAQFAAAYPQADRFRATKAVWDPQGRMRNMLWAQYL