Protein Info for Ac3H11_738 in Acidovorax sp. GW101-3H11

Annotation: C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02464: CinA
  • amino acids 25 to 170 (146 residues), 190.8 bits, E=5.9e-61
• TIGR00199: amidohydrolase, PncC family
  • amino acids 29 to 170 (142 residues), 156.2 bits, E=3.3e-50

Best Hits

Swiss-Prot: 54% identical to PNCC_PSEPU: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Pseudomonas putida

KEGG orthology group: K03743, (no description) (inferred from 70% identity to vei:Veis_0581)

MetaCyc: 51% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

No annotation

MetaCyc Pathways

• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

See A0A165JBK7 at UniProt or InterPro

Protein Sequence (175 amino acids)

>Ac3H11_738 C-terminal domain of CinA type S; Protein Implicated in DNA repair function with RecA and MutS (Acidovorax sp. GW101-3H11)
MTTAPLSNKELLALDTSALEANLTQISLELLKHKHLLATAESCTGGMIAAACTDLAGASD
WFERGFVTYSNAAKTEMLGVPAALIEQEGAVSEAVARAMADGALTHSQAHVSLAVTGVAG
PTGGSDAKPVGTVWFAWCVGGETHSEVQHFPGDRAAIRAATLRYALQRLLGHLLA