Protein Info for Ac3H11_735 in Acidovorax sp. GW101-3H11

Annotation: FIG00581584: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR02292: yecA family protein" amino acids 59 to 274 (216 residues), 46.4 bits, see alignment E=1.7e-16 PF03695: UPF0149" amino acids 61 to 280 (220 residues), 122.1 bits, see alignment E=3.1e-39 PF02810: SEC-C" amino acids 297 to 314 (18 residues), 38.6 bits, see alignment (E = 7.9e-14)

Best Hits

KEGG orthology group: K07039, uncharacterized protein (inferred from 79% identity to cti:pRALTA_0039)

Predicted SEED Role

"FIG00581584: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JBG8 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Ac3H11_735 FIG00581584: hypothetical protein (Acidovorax sp. GW101-3H11)
VARATAQGLRIIKVKHCFAAPAFSLDDRSPPMTEPTSPTPATDDLDPTTAPAAALGPDEL
EEMDNILDDLRARGEEIPQWEFCDGFMTALICSRRPIGPAEYLPMLLGDGAELDVAEGDP
LPLLPAFADAAQQARFMDLWMRRWNEIVAQLDTDVKTLDDDRTFQPEAMDMRGAVASLTD
EQRAEMGDDQEIPSFGQVWALGFMFAVENWPEDWAAPRDKEAAKWLDDALDRIVALTEDD
TGKPEVCMYDEDGAPSTSQARVEAFGEAIWAVYDLRQLWKSMGPRVETVRKAPEPGRNDP
CHCGSGKKYKKCHGA