Protein Info for Ac3H11_719 in Acidovorax sp. GW101-3H11

Annotation: Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 230 to 256 (27 residues), see Phobius details amino acids 319 to 330 (12 residues), see Phobius details amino acids 335 to 351 (17 residues), see Phobius details amino acids 353 to 355 (3 residues), see Phobius details amino acids 359 to 385 (27 residues), see Phobius details PF00375: SDF" amino acids 20 to 412 (393 residues), 361.2 bits, see alignment E=3.5e-112

Best Hits

Swiss-Prot: 87% identical to DCTA_DELAS: C4-dicarboxylate transport protein (dctA) from Delftia acidovorans (strain DSM 14801 / SPH-1)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 92% identity to adk:Alide2_4442)

MetaCyc: 58% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JB04 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Ac3H11_719 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate (Acidovorax sp. GW101-3H11)
MHAISAPTAHPVRLPFYRQLYFQVVLAIVLGVLLGHFEPSYGEALKPLGDAFIKLVKMII
APVIFLTIVTGIAGMSQLSTVGRVFGKAMAYFLFFSTLALVVGLVVANVVQPGAGMNINV
ADLDQSAVKGYVAKSHEMTLTGFALDIIPKTLVSPFVGDNILQVLLVAVLFGVGLAMVGD
AGRPVLNFLDALTTPVFKVVGIVMKAAPLGAFGAMAFTIGKFGLGSLVNLAWLVGSFYIT
SLLFVVVILGFVARLCGFSVFKLCRYLKAELMLVLGTSSSESALPSLMEKMEKAGCSKSV
VGLVVPTGYSFNLDGTNIYMTLAALFIAQATNTELTLGHQVALLLVAMLSSKGAAGVTGA
GFITLAATLAVVPEVPVAGMALILGVDRFMSECRSLTNFIGNAVATVVVSRWENALDHER
LDAALNGHPLPAAVTAAAAPVVPADMPVGAVARTVA