Protein Info for Ac3H11_61 in Acidovorax sp. GW101-3H11

Annotation: Tricarboxylate transport membrane protein TctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 44 to 44 (1 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 101 to 128 (28 residues), see Phobius details amino acids 140 to 156 (17 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 347 to 371 (25 residues), see Phobius details amino acids 383 to 400 (18 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 463 to 481 (19 residues), see Phobius details PF01970: TctA" amino acids 13 to 431 (419 residues), 526.5 bits, see alignment E=2.2e-162

Best Hits

Swiss-Prot: 47% identical to YZ2R_AGRVI: Uncharacterized 52.8 kDa protein in TAR-I ttuC' 3'region from Agrobacterium vitis

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 92% identity to vei:Veis_0397)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165HZC3 at UniProt or InterPro

Protein Sequence (494 amino acids)

>Ac3H11_61 Tricarboxylate transport membrane protein TctA (Acidovorax sp. GW101-3H11)
MQGFATAATPINLLWAFVGCMIGTAVGVLPGIGPAVAVAMLLPITVKVEATASMIFFAGI
YYGAMYGGSTTSILLNTPGEAGSMVTAMEGNKMAKNGRAGAALATAAIGSFVAGTIATVL
VTFFAPLVAEYAVRLGPPEYFMLMVLAFTTVSAVLGKSTLRGMVALFVGLAMGLIGIDQL
TGQARYTGGVPELMDGIEVVLIAVGLFAVGEALYNVMYEGKTDETQNRLTSTHMTKEEWK
RSWPAWLRATFIGFPFGTVPAGGSEIPTFLSYAAEKKLSKNKEEFGTTGAIEGVAGPEAA
NNAAITATLIPLLTLGIPTSNTTAILLGAFQNYGIQPGPQLFDTNGALVWALIASMYIGN
VMLLILNLPLVGLWVKLLNIPKSYLYAGILVFSTLGVYGMRQSAFDLVLLYAIGLLGVVM
RRFDFPAAPVVVGMILGPLAEAQMRNAVAIGEGKWTIFLERPGSVTLIVIVLAVLIVPRL
LRRWAARKMALAQT