Protein Info for Ac3H11_578 in Acidovorax sp. GW101-3H11

Annotation: Putative sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 6 to 53 (48 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 156 to 186 (31 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details PF01925: TauE" amino acids 7 to 264 (258 residues), 158.5 bits, see alignment E=1.2e-50

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 86% identity to aav:Aave_3052)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165IR29 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Ac3H11_578 Putative sulfate permease (Acidovorax sp. GW101-3H11)
MHELAFVFAGFAVGLIVGLTGVGGGSLMTPILIFFFGVKPHMAVGTDLLFAAFTKMGGTV
SLARQRLVPWKVVGQLCAGSIPAALLALWALKAMGPASGTAQSIMTTTLGFALLLTAAAT
LYKAIAFSAQRQAAEAAARKAHAGDPTRPRHWSLPVLLGAVIGTLVTFTSVGAGAIGVTV
LLLVYPLLPLPRVIGADIAYAVPLTLVAGLGHASLGSVDWPLLAQLLAGSLPGIWLGSRL
VTRTPERLIRSALSVLLAWAGFKLILI