Protein Info for Ac3H11_575 in Acidovorax sp. GW101-3H11

Annotation: Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01507: PAPS_reduct
  • amino acids 39 to 186 (148 residues), 98.4 bits, E=2.5e-32

Best Hits

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 88% identity to ajs:Ajs_1793)

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Sequence Analysis Tools

See A0A165IR05 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Ac3H11_575 Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) (Acidovorax sp. GW101-3H11)
MSQFDLAHINAELGRNAEGLVAWALGLGQSPIVTTNFRPFEAVILHMVSQVNPDVPVVWM
DNGYNTEATYRFADEVTKQLGLNLKIYLPRRSRAHREAVEGTTPGLDDPRHAAFTEEVKL
EPFARALRETAPKVWFTALRATDTAVRAQMDPVSINPDGLIKVAPLLHWSSKELHEYCVR
HGLPNNFDYVDPTKGEDNRECGLHIAH