Protein Info for Ac3H11_57 in Acidovorax sp. GW101-3H11

Annotation: Tricarboxylate transport sensor protein TctE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details PF08521: 2CSK_N" amino acids 28 to 179 (152 residues), 129.8 bits, see alignment E=1.9e-41 PF00672: HAMP" amino acids 201 to 251 (51 residues), 23.5 bits, see alignment 1.4e-08 PF00512: HisKA" amino acids 257 to 318 (62 residues), 46.9 bits, see alignment E=5.9e-16 PF13581: HATPase_c_2" amino acids 361 to 447 (87 residues), 28.4 bits, see alignment E=3.5e-10 PF02518: HATPase_c" amino acids 368 to 472 (105 residues), 74.9 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 76% identity to adn:Alide_1911)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165I0R0 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Ac3H11_57 Tricarboxylate transport sensor protein TctE (Acidovorax sp. GW101-3H11)
MNPGTTQNVARHHSLRRRLLLGILLPVALFIGFNTWSLYRQTLASLNTAYDRTLLASAKS
ISEQLDVKGFDDAAQLRAIVPYSALEAFEADNQSQMFYRVSTLSGEMVSGFEDLPVWRGS
IPDKPPYAALVDFYDDQFRDRDVRVAVLLQPVASSQGRAMAVIQVAETLEVRETLALQIL
WNTLLRQALLIAVIAFTVVLVVQRATRPVRQLSQQLQARREGDLSPIAAPTAPRELQPLV
DATNEVMQRLRHLLRHQKRFVRDASHQLRTPLAVLKTQVQSALRGDVEPHQALHEISDTV
DRATQLANQMLALAKVEQLRQQSAPPATRFDDILRAVALEISPLIAQRDLDFGIHTEPAL
VQSHEWMLRELSRNLLHNAVRHAPPGSELTVDLRSDGRHVALAISDHGPGIDDELAARLF
QPFSAGDVRTGSGLGLAICREIVQALEGSITLTNRIAGHRVAGLDAVVRLPLPTAAADGP
PEAQAAQSRP