Protein Info for Ac3H11_545 in Acidovorax sp. GW101-3H11

Annotation: Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details PF00775: Dioxygenase_C" amino acids 59 to 198 (140 residues), 89.5 bits, see alignment E=9.7e-30

Best Hits

KEGG orthology group: K00449, protocatechuate 3,4-dioxygenase, beta subunit [EC: 1.13.11.3] (inferred from 66% identity to lch:Lcho_0120)

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LKL1 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Ac3H11_545 Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3) (Acidovorax sp. GW101-3H11)
MPVHTGSTPSSPRPAPAAVPTRRRLLRQGLWGSALVVAPALVPAALAQGALTPTPRQTEG
PYYPVRFPSDSDGDLLRNGLMRYVDGQPVWVEGRVTDMQGVPLAGGTVEIWQCDADGHYH
HPGDGNKAAPAFQGFGRVVLGRDGRYRFRTIRPAPYTGRTPHIHFKVRLPDRELLTTQMY
VAGNPGNTSDFLWSRLSAAERAALTVPFAPSADGVRAEFALVVQA