Protein Info for Ac3H11_500 in Acidovorax sp. GW101-3H11

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 196 to 222 (27 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 29 to 375 (347 residues), 159.5 bits, see alignment E=1.3e-50 PF01061: ABC2_membrane" amino acids 234 to 343 (110 residues), 38.3 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 68% identity to dac:Daci_4569)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LID7 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Ac3H11_500 ABC-type multidrug transport system, permease component (Acidovorax sp. GW101-3H11)
MTALLSQPATPHNLLHAWLAALATVVRDKGVLLLLIGAPVLYGFFYPWFYADEVLTRVPV
AVVDMDRTSLSRQITRFADADPRIEVRLVTGSEHEAQQALWRGEIEGYAVIPPHLKRNVV
RGENAVVSIEANGAYALLNKAVQFGFAEAVGTVSAGVEIRKLQASGQSALQARASRAPVQ
LQTVALFNPIEGYGSFVVPAVALLILQQTLLMGAALLAGTWVEAGQHRASATTWLGRLLA
LSTLGWASGLFYFGWIFVLHDYPRGGNPLGALALLACYVPAIAALGSLLGLWFGNRERAL
QVLLFTTLPIAFVAGFSWPVEALPEPLQWLRWLLPSTSGVQASLRLNQLGAPLQAALPYL
CGLVVLGAVCSAAVLYKARPLALAQVS