Protein Info for Ac3H11_50 in Acidovorax sp. GW101-3H11

Annotation: tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 18 to 202 (185 residues), 151.8 bits, see alignment E=1.1e-48 PF01171: ATP_bind_3" amino acids 19 to 198 (180 residues), 169 bits, see alignment E=9.4e-54 PF09179: TilS" amino acids 246 to 306 (61 residues), 48.3 bits, see alignment E=9.9e-17

Best Hits

Swiss-Prot: 43% identical to TILS_BORPE: tRNA(Ile)-lysidine synthase (tilS) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 81% identity to vei:Veis_4939)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.-

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165HZ28 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Ac3H11_50 tRNA(Ile)-lysidine synthetase (EC 6.3.4.19) (Acidovorax sp. GW101-3H11)
MTQSFDAALQAFAPALPLAVALSGGADSTALLLACARRWPGQVRAIHVHHGLQAAADGFE
QHCIALCQRLDVPLVVQRLDARHAPGQSPEDAARQARYQAFEAFARDHIPKNAIKSIALA
QHADDQAETLLLALSRGAGVAGLAAMPARWERAGIVWHRPLLQVAGADVRHWLRAQGQAW
VEDPTNTDERFTRNRIRAQLLPALDAAFPSFRDTFARSADNAAQAAELLHELAQQDLALV
GMPPQIKALQGLSRARQANVLRHWLRLAHHTTPAAAQLGELLDQILACTTRGHQIRIKVG
RGFVVRSGSGLDWSSP