Protein Info for Ac3H11_4986 in Acidovorax sp. GW101-3H11

Annotation: High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 49 to 57 (9 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 36 to 377 (342 residues), 195.1 bits, see alignment E=2.9e-61 PF01094: ANF_receptor" amino acids 65 to 356 (292 residues), 43 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 91% identity to adk:Alide2_4263)

Predicted SEED Role

"High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JIY9 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Ac3H11_4986 High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1) (Acidovorax sp. GW101-3H11)
MDTQRTSFQRRQLLLGAAGAAALTSPLSVLAQGAEEIVIGGSIPLTGVFAFAGVGINAGM
GDYVKMLNDAGGIKGRKVKYVPEDTGYKVDVSVAAFKKITSQNKVNLYYGDSTGFSKTIN
PELDRNGNILMAGASFATELNDPKKYPSQFLVGPDYTEMFGILLKHIAKEKPGAKVAFVY
SDSEFGRDPIESSEAMAKQLGLSVPIKIMTPAGSVDVSTEVIKLRRAAPDYTIFHGYILA
PIPEFITQGKQQGMTSKWMGTFWTMDSSTVMKMGEAADGFMGVMPYRYYYDTEKAPMLEK
IRALRPEYQSTAYIQGFLAAMLFTEAAKRTLDAGKPLTGPNLKAALNSIKDFDTGGLIGV
PITISGNSIPVGRVYRADMKAQKMVAASDWIKL