Protein Info for Ac3H11_497 in Acidovorax sp. GW101-3H11

Annotation: FIG028593: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details PF06127: Mpo1-like" amino acids 1 to 145 (145 residues), 71.6 bits, see alignment E=2.4e-24

Best Hits

KEGG orthology group: None (inferred from 79% identity to aaa:Acav_2535)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LIC0 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Ac3H11_497 FIG028593: membrane protein (Acidovorax sp. GW101-3H11)
MKTLIDHLAQYADYHRDPRNIHTHFVGVPMIMFAVVILLSRPTWMAGALPLSPALLAALA
ASVFYFRLDTRFGLAMAALLAAMLVGGQWVALQSLAVWLATGIGLFAVGWVIQFVGHYYE
GRKPAFVDDLVGLIVGPLFVVAEWAFALGLRKEVQAAIEARSGPVRLRTGQAAA