Protein Info for Ac3H11_487 in Acidovorax sp. GW101-3H11

Annotation: Molybdenum cofactor biosynthesis protein MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 37 to 384 (348 residues), 382.3 bits, see alignment E=9.1e-119 PF04055: Radical_SAM" amino acids 50 to 219 (170 residues), 118.4 bits, see alignment E=5.7e-38 PF13353: Fer4_12" amino acids 55 to 165 (111 residues), 26.3 bits, see alignment E=1.3e-09 PF06463: Mob_synth_C" amino acids 227 to 360 (134 residues), 120.3 bits, see alignment E=7.9e-39

Best Hits

Swiss-Prot: 70% identical to MOAA_RALSO: GTP 3',8-cyclase (moaA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 81% identity to aav:Aave_2659)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LI68 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Ac3H11_487 Molybdenum cofactor biosynthesis protein MoaA (Acidovorax sp. GW101-3H11)
MRQNHAMAERVIPLVDQRIAALAARVPTHPVAPTGQLTDTLGRPLRDLRISVTDRCNFRC
NYCMPKEVFDKDYPYLPHGALLSFEEITRLARLFLAHGVRKIRLTGGEPLLRKNLEELVA
QLAQLRTVDGLPPDLTLTTNGSLLARKAQALKDAGLNRVTVSLDGLDDAVFRRMNDVDFP
VADVLAGIEAAHAAGLSQIKVNMVVKRGTNEHEILPMARHFRGTGTTLRFIEYMDVGATN
GWRMDEVLPSAELIERLRAELPLVQLDPSSPGETAERWGYANAAGQHDPSLGEVGVISSV
TQAFCHDCNRARLSTEGKLYLCLFATQGYDLRTLLRGGASDEAIASAIAPIWQQRTDRYS
ELRSSLPADTGHGARRVEMSYIGG