Protein Info for Ac3H11_484 in Acidovorax sp. GW101-3H11

Annotation: Molybdopterin biosynthesis protein MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 339 to 360 (22 residues), see Phobius details PF03453: MoeA_N" amino acids 28 to 186 (159 residues), 141.6 bits, see alignment E=2.7e-45 TIGR00177: molybdenum cofactor synthesis domain" amino acids 196 to 362 (167 residues), 94.6 bits, see alignment E=2.8e-31 PF00994: MoCF_biosynth" amino acids 201 to 365 (165 residues), 113.7 bits, see alignment E=9.3e-37 PF03454: MoeA_C" amino acids 379 to 451 (73 residues), 65 bits, see alignment E=8.7e-22

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 82% identity to dia:Dtpsy_1971)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LI51 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Ac3H11_484 Molybdopterin biosynthesis protein MoeA (Acidovorax sp. GW101-3H11)
MKTIAQIAAELQGYDPQALKAADVNAFLDRLVEPVTATEELPLFNALGRVLARDVVSPIS
VPPHDNSAMDGYAFAGAQLAKGQPLTLRVVGTALAGKAWAGTVAAGECVKIMTGAIMPAG
LDTVVPQEFTTSTTTDGAEHITIAADVLQLGDNRRFKGEDLMEGGVALARGELLTPAALG
LVASLGLPTVTVVRRLRVAYFSTGDEILSLGEAPREGAVYDSNRYTVFGLLTRLGVEVID
LGVVRDEPALLEAAFRQAAQQADAIITSGGVSVGEADHTRTMMKKLGDVAFWRIAMRPGR
PMAVGRIAAAGFGEKTASTAQPSSPDSYKTNSNPHSSAGAVLFGLPGNPVAVMVTFLAFV
RPALLRMMGSTRTTPPLLRAVSTEAMRKKPGRTEYQRGLVTTAADGTLQVCTTGNQGSGV
LSSMVQANGLIVLHHSQGNVAVGDMVDVMVFDGVI