Protein Info for Ac3H11_4787 in Acidovorax sp. GW101-3H11

Annotation: Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 109 to 136 (28 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 292 (185 residues), 65.1 bits, see alignment E=3.6e-22

Best Hits

Swiss-Prot: 60% identical to UGPA_YERPS: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K05814, sn-glycerol 3-phosphate transport system permease protein (inferred from 85% identity to del:DelCs14_1144)

MetaCyc: 60% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L922 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Ac3H11_4787 Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3) (Acidovorax sp. GW101-3H11)
MEKRVLFRSAWLPWVLLAPQLAIISVFFFWPAGQALVQSFQMQDSFGMSTEWVGLDNFKH
LFEDPGYLASFKTTAFFSILVAAVGIGLSLILAIFADRIIKGAMVYKTALLLPYAVAPAV
AGVLWMFMFSPSLGVVAYMLRQSGFDWNHMLNSDHAMGLIVIAAVWKQISYNFLFFLAGL
QSIPKSLIEAAAIDGAGPWRRFWSIQFPLLSPTTFFLLVINVVYAFFDTFAIVDATTQGG
PGRDTAILVYKVYHDGFKAMDMGGSAAQSVVLMAIVVVLTVIQFRYVEKKVQY