Protein Info for Ac3H11_4765 in Acidovorax sp. GW101-3H11

Annotation: Type IV fimbrial assembly protein PilC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 172 to 195 (24 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details PF00482: T2SSF" amino acids 72 to 195 (124 residues), 120.3 bits, see alignment E=2.5e-39 amino acids 276 to 398 (123 residues), 104.8 bits, see alignment E=1.6e-34

Best Hits

Swiss-Prot: 50% identical to TAPC_AERHY: Type IV pilus assembly protein TapC (tapC) from Aeromonas hydrophila

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 92% identity to aav:Aave_3681)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L8I6 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Ac3H11_4765 Type IV fimbrial assembly protein PilC (Acidovorax sp. GW101-3H11)
MATAASKRDLKDFVFEWEGKDRHGKIVRGEVRAVGENQVQATLRRQGVFPTKIKKRRMRS
GKKIKPKDIALFTRQLATMMKAGVPLLQAFDIVGRGNTNASVTKLLNDIRADIETGTSLN
GAFRKYPMYFDSLYCNLVEAGEAAGILEALLDRLATYMEKTEAIKSKIKSALMYPISVVI
VAFVVVTVIMIFVIPAFKEVFTSFGADLPAPTLFVMAISEIFVKWWWLIFGAIGGSFFFF
MQAWRRNEKMQMFMDRLLLRMPVFGALIDKSCVARWTRTLATMFAAGVPLVEALDSVGGA
AGNSVYSMATEKIQQEVSTGTSLTAAMGNANVFPSMVLQMCAIGEESGSIDHMLGKAADF
YESEVDDMVAGLSSLMEPIIIVFLGTLIGGIVVSMYLPIFKLGQVV