Protein Info for Ac3H11_4737 in Acidovorax sp. GW101-3H11

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 25 to 53 (29 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 114 (16 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 73% identity to aav:Aave_1050)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165L824 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Ac3H11_4737 Probable transmembrane protein (Acidovorax sp. GW101-3H11)
MSDIVDVQTNDQRAQSLKNIGWVSYVLHLIVAVGAVLPGAQASALLLVIALVIDLVKRGD
AEGTWQANHFSWRIRSTIWVGVLYIVTAPLWLLLIAPGWIAWGIISLWFLYRIVRGMLAM
SNNRAVDA