Protein Info for Ac3H11_4582 in Acidovorax sp. GW101-3H11

Annotation: Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF16576: HlyD_D23" amino acids 222 to 453 (232 residues), 148.4 bits, see alignment E=3.8e-47 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 232 to 515 (284 residues), 169.5 bits, see alignment E=4.4e-54 PF13533: Biotin_lipoyl_2" amino acids 241 to 277 (37 residues), 26.5 bits, see alignment 8.5e-10 PF13437: HlyD_3" amino acids 351 to 450 (100 residues), 69.1 bits, see alignment E=1e-22

Best Hits

Swiss-Prot: 56% identical to CZCB_CUPMC: Cobalt-zinc-cadmium resistance protein CzcB (czcB) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: None (inferred from 98% identity to ajs:Ajs_1848)

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LSR5 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Ac3H11_4582 Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family (Acidovorax sp. GW101-3H11)
MTMNTNSSKSTISKKHLIAIAVVLAIGGGAGTFILQGGGKPKAAATEDDGHGHGGHTEAK
GHGDGEHHGKGSEKGHDDDKGHADGEHHEKSEAKGPHGGTVFKEGDFSLEALLSEDGGEP
RLRIWLSDKDKPLPLNAATVTATVTRPTDEKQKLTFAAEKDSLVSREIVAEPHAFDIEII
AQTATEPFMFVMSKEEGKIELTDAQIKAASISLDAAVKANIKTALLLPGEIRLNEDRTSH
VVPRLAGVVESVNASLGQVVKKGQVLAVIASPTASEQRSELQTAQKRLSLAKTTYEREKK
LWEQKVSAEQDYLQAKQALSEAEVAVANANQKLSAMGLSASSVAGLNRIELRAPFDGIVI
EKHLSLGEAVKEDAAVFTISDLSQVWAEINVPAKDLPSVRVGEKVTIKATAFDASATGTV
AFVGALIGEQTRTAKARVVLDNPKGAWRPGLFVNVEVVSEETAAPVTISADAVQNVGEKP
VVFLKVDGGFIAQPVKLGRSDGKRVEVLSGLKAGMPYASTGSFVVKSELGKGSAEHTH