Protein Info for Ac3H11_4572 in Acidovorax sp. GW101-3H11

Annotation: Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF13437: HlyD_3" amino acids 77 to 173 (97 residues), 44.2 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: None (inferred from 46% identity to pag:PLES_26191)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LPN5 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Ac3H11_4572 Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA (Acidovorax sp. GW101-3H11)
VLAYVAHHAEPYAQANQQAQLAELRSGRELAAQRVQRLQSLEGTVPRKEIEAARAELQSL
TAREKSIGASLAAREALLAPVSGVIARADATKGQVVEAREVLFEVIDPARVLVEATTADP
GLPARTGTAHLQGVLGVKLQLIGAARSLRDGVLPMTFRAVPEQSGTALPLAVGQPVTVVA
SLNEQVKGFVLPAQAVVRNSANEPVVWIKSGAERYIPQPVQYRSLDAATVVVTQGLGADN
RVVVQGAPLIAQIR