Protein Info for Ac3H11_4487 in Acidovorax sp. GW101-3H11

Annotation: Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 129 to 148 (20 residues), see Phobius details PF04187: Cofac_haem_bdg" amino acids 52 to 237 (186 residues), 117.2 bits, see alignment E=5.3e-38

Best Hits

KEGG orthology group: None (inferred from 61% identity to aav:Aave_0652)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LML6 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Ac3H11_4487 Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1) (Acidovorax sp. GW101-3H11)
MQRPLPSFLRSRWAEGTRAAALGCTLLVLAGCAGTLPPATIQAAPWPERLHTLLPADVLL
LGEQHDAPDHQRLQREAVLWLAARGQLAALVLEMAESGHSTQSLPPGATEAQVQAALQWN
DAAWPWKAYGPVVMGAVAAGVPVLGGNLPRAQMRAAMQEPAWDQHLPPAALARQITALRD
GHCGLLPESQLAPMARIQIARDASMARTAQQALRPGQTVLLVAGGGHVLRSIGVPTHWPD
TLRSKVALGRVQQAQPAIKKEALQATDTGAHAPADADAVIDTPALPPRDACAELREQWRT
APRGQR