Protein Info for Ac3H11_4462 in Acidovorax sp. GW101-3H11

Annotation: Probable proline rich signal peptide protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF14334: DUF4390" amino acids 30 to 193 (164 residues), 162.5 bits, see alignment E=3e-52

Best Hits

KEGG orthology group: None (inferred from 70% identity to vei:Veis_2267)

Predicted SEED Role

"Probable proline rich signal peptide protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LLZ4 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Ac3H11_4462 Probable proline rich signal peptide protein (Acidovorax sp. GW101-3H11)
LLFCAAVLWLCLWAGLLAAPATAAQAANAANAEVGELRLERAEDGLYLGANLQFDLPELA
EDALYKGIPMFFVADAQVLRDRWYWSDRLVAETTRYFRLSYQPLTRRWRLNISAVPFTNS
GLGVVLGQNFDSYDEAMASIQRFSRWKIAERDVIESDAVHTVNFRFRLDMSQLPRPFQIG
AVGRSGWNLLVSRSQRLGAEQAR