Protein Info for Ac3H11_443 in Acidovorax sp. GW101-3H11

Annotation: Dihydropteroate synthase (EC 2.5.1.15)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR01496: dihydropteroate synthase" amino acids 16 to 272 (257 residues), 305 bits, see alignment E=2.4e-95 PF00809: Pterin_bind" amino acids 18 to 257 (240 residues), 253.9 bits, see alignment E=9.3e-80

Best Hits

Swiss-Prot: 50% identical to DHPS_NEIMB: Dihydropteroate synthase (folP) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K00796, dihydropteroate synthase [EC: 2.5.1.15] (inferred from 80% identity to ajs:Ajs_2382)

MetaCyc: 48% identical to dihydropteroate synthase (Escherichia coli K-12 substr. MG1655)
Dihydropteroate synthase. [EC: 2.5.1.15]

Predicted SEED Role

"Dihydropteroate synthase (EC 2.5.1.15)" in subsystem Folate Biosynthesis (EC 2.5.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165LHA6 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Ac3H11_443 Dihydropteroate synthase (EC 2.5.1.15) (Acidovorax sp. GW101-3H11)
MIWQTSRFSIDLERPKVMGIVNVTPDSFSDGGHHASAIAALRHCEQLLKDGADILDIGGE
STRPGSPAVPLDEELARVVPLVREVVALGVPISVDTYKPAVMRAVLDLGADIVNDIWALR
QPGALAVVAAHPQCGVCLMHMHRDPQTMQAAPMTGDVVPQVLSFLELQAHNLQAQGAKKD
QILLDPGIGFGKTVEQNFALLARQDVLLRAGYPLLAGWSRKSSLGAVTGLDVDQRMVPSV
AAAVLAVDRGASVVRVHDVRETVAALAVWSAMQRTG