Protein Info for Ac3H11_44 in Acidovorax sp. GW101-3H11

Annotation: TPR repeat precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13174: TPR_6" amino acids 65 to 93 (29 residues), 14.4 bits, see alignment (E = 1.9e-05) amino acids 100 to 126 (27 residues), 15.6 bits, see alignment (E = 8e-06) PF14559: TPR_19" amino acids 74 to 129 (56 residues), 28.3 bits, see alignment E=7.3e-10 PF13431: TPR_17" amino acids 84 to 115 (32 residues), 26.1 bits, see alignment (E = 2.7e-09) PF13181: TPR_8" amino acids 96 to 127 (32 residues), 17.9 bits, see alignment (E = 1.1e-06) PF13414: TPR_11" amino acids 105 to 142 (38 residues), 31.2 bits, see alignment 5.7e-11

Best Hits

KEGG orthology group: None (inferred from 69% identity to aaa:Acav_2811)

Predicted SEED Role

"TPR repeat precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165HYY3 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Ac3H11_44 TPR repeat precursor (Acidovorax sp. GW101-3H11)
MKPVLRTLPQLLRLVALTALLGAGVAHAEDYSDITQLLKTGKAAEALVKADQRLAATPRD
PQLRFLRGVAQADSGKQGEAITTFTKLTEEYPELPEPYNNLAVLYANQNQLDKARTALEM
AIRTNPSYATAHENLGDIYAKLASQAYNKALQLDATSANSVKPKLALIRELFSADAASKS
GRPAAAAPVPAAVVATQRPAPAAAAPAPAAPTPAPATAAAPAPAATPAATAPAPTPAPAP
AAASDASTQAVTAAVQAWAAAWAAKDMKAYLGAYDKSFDPPGNQNRAAWEKERESRIVGK
SKISVKLSDIAVSVQGDKATARFRQAYSADALNVTSRKTLDLVNSNGRWAIVRESTGG