Protein Info for Ac3H11_4357 in Acidovorax sp. GW101-3H11

Annotation: Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 201 (201 residues), 188.5 bits, E=3.9e-60
• PF00677: Lum_binding
  • amino acids 3 to 88 (86 residues), 62.7 bits, E=1.3e-21
  • amino acids 101 to 186 (86 residues), 72.7 bits, E=1e-24

Best Hits

Swiss-Prot: 38% identical to RISA_BUCAP: Riboflavin synthase (ribE) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: None (inferred from 88% identity to xtr:100496516)

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Sequence Analysis Tools

See A0A165K481 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Ac3H11_4357 Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9) (Acidovorax sp. GW101-3H11)
MFTGIVQATAGIAAIHDRAGLRTFTLDFPEGFCQDLAIGASVATDGVCLTVTEILSPTQA
NFDVMLQSLNITTLGSYAQGDRVNVERAAKDGAEIGGHPLSGHVDFTGTLIERREFDNNL
VWRVAVPEAFRRYVFAKGYIAIHGASLTVAEVNRQEGWFEIWMIPETRRATVFENKQVGD
RLNIEIERSTQVVVDTVREAVQESLGRLQPVLEALLKEKGLSLDDFVQAPVLPH