Protein Info for Ac3H11_4332 in Acidovorax sp. GW101-3H11

Annotation: Adenylylsulfate kinase (EC 2.7.1.25)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 9 to 174 (166 residues), 175.6 bits, E=4.2e-56
• PF01583: APS_kinase
  • amino acids 12 to 165 (154 residues), 171.9 bits, E=2e-54
• PF13671: AAA_33
  • amino acids 14 to 126 (113 residues), 38.4 bits, E=3e-13
• PF06414: Zeta_toxin
  • amino acids 15 to 52 (38 residues), 23.4 bits, 7e-09
• PF08433: KTI12
  • amino acids 16 to 72 (57 residues), 24.4 bits, E=4e-09

Best Hits

Swiss-Prot: 50% identical to CYSC_SHEAM: Adenylyl-sulfate kinase (cysC) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 49% identity to rso:RSp0166)

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See A0A165K3H3 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Ac3H11_4332 Adenylylsulfate kinase (EC 2.7.1.25) (Acidovorax sp. GW101-3H11)
VPLFMKKPETATTWWLTGLPGAGKTTLAQALAAALRERGEPACVIDGDELRTGLCKDLGF
DEASRAENVRRAAHMAQLLNANAIHAVVAMVSPAAPARAAAYATIGVDRCKEVHVSTPLE
VCEKRDPKGLYARARANQLTQMTGIHAGYEAPGSPALRIDTSQTDLQVAVQQLLRA