Protein Info for Ac3H11_4327 in Acidovorax sp. GW101-3H11

Annotation: SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase (EC 2.1.1.182)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 5 to 256 (252 residues), 244.2 bits, see alignment E=6.8e-77 PF00398: RrnaAD" amino acids 6 to 252 (247 residues), 203.6 bits, see alignment E=1.6e-64

Best Hits

Swiss-Prot: 86% identical to RSMA_ACIET: Ribosomal RNA small subunit methyltransferase A (rsmA) from Acidovorax ebreus (strain TPSY)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 86% identity to dia:Dtpsy_3468)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K3E2 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Ac3H11_4327 SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase (EC 2.1.1.182) (Acidovorax sp. GW101-3H11)
LKHIPRKRFGQHFLSDHGIIDGIVSAIAPQPGQPMVEIGPGLAALTQPLVERLGRLTVIE
LDRDLALRLRLHGQLDVIESDVLKVDFTALAQTLREKAGQPGLRLRVVGNLPYNISTPIL
FHLLAHVQVIEDQHFMLQKEVIDRMVASPATGDYGRLSVMLQWRYAMENVLFVPPESFDP
PPRVDSAVVRMVPHAEPAPLSVPVLEELVQVAFSQRRKLLRHTLGRWLEARQFAGTFDTQ
RRAEEVPVAEYVALAQDFS