Protein Info for Ac3H11_4316 in Acidovorax sp. GW101-3H11

Annotation: Alkanal monooxygenase alpha chain (EC 1.14.14.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 TIGR04027: putative FMN-dependent luciferase-like monooxygenase, KPN_01858 family" amino acids 2 to 319 (318 residues), 532.5 bits, see alignment E=1.7e-164 PF00296: Bac_luciferase" amino acids 5 to 279 (275 residues), 138 bits, see alignment E=2.4e-44

Best Hits

KEGG orthology group: None (inferred from 72% identity to dac:Daci_1053)

Predicted SEED Role

"Alkanal monooxygenase alpha chain (EC 1.14.14.3)" (EC 1.14.14.3)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K337 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Ac3H11_4316 Alkanal monooxygenase alpha chain (EC 1.14.14.3) (Acidovorax sp. GW101-3H11)
VPAGERYRLVTEQIAHAEAFGFDSAWVAQHHFHEHEGGLPSPFVFLAHVAARTRRIRLGT
GIVTLPMENAVRVAEDAIVLDLLSGGRLELGVGTGGTPESFAAFGITSEDRSAVYARHLA
VVREAWAGRPLPGGDRLYPAAEQLLGRIWQATFSVAGGERAGQAGDGLMLSRTQPRTADA
PNASLSDLQHPIIDAYLAALPAGSTPRIVGSRSLFVADDRNEALRLADVGLRRSASRFAA
AVSPGQAPRPGPDAPLETLIAAYDVHVGTPDDVIASLRADTALARTTDIVFQVHSVDPPH
AQILRSIELTATHVAPALGWVRKQPGNATAASLATPTSATRIEAFA