Protein Info for Ac3H11_4278 in Acidovorax sp. GW101-3H11

Annotation: Methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF13489: Methyltransf_23" amino acids 5 to 133 (129 residues), 48.6 bits, see alignment E=2.3e-16 PF07021: MetW" amino acids 6 to 190 (185 residues), 223.8 bits, see alignment E=4.6e-70 TIGR02081: methionine biosynthesis protein MetW" amino acids 7 to 191 (185 residues), 239.5 bits, see alignment E=1.1e-75 PF13847: Methyltransf_31" amino acids 17 to 143 (127 residues), 33.6 bits, see alignment E=9.4e-12 PF13649: Methyltransf_25" amino acids 20 to 107 (88 residues), 43.7 bits, see alignment E=1.1e-14 PF08242: Methyltransf_12" amino acids 21 to 104 (84 residues), 36.1 bits, see alignment E=2.6e-12 PF08241: Methyltransf_11" amino acids 21 to 108 (88 residues), 53.4 bits, see alignment E=1e-17

Best Hits

KEGG orthology group: None (inferred from 94% identity to vei:Veis_0146)

Predicted SEED Role

"Methionine biosynthesis protein MetW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165K215 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Ac3H11_4278 Methionine biosynthesis protein MetW (Acidovorax sp. GW101-3H11)
MTDKAAMQALARLVPPGSRVLDLGCGNGAMLDYLQRERGCSGYGVEIDDANVLACVQRGV
DVIQLNLDEGLAMFDDNSFDVVLQIDTLQHLRNAETMLRETARVGRTGVVAFPNFAHWPN
RLSILRGRMPVTRRLPYQWYDTPNIRVGTYKDFEVLATKNDLRILDAFGLQDGEEVRWLP
NARAGTAVFHFEHA